PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN28145.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 479aa    MW: 51885.3 Da    PI: 7.2579
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN28145.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.53.4e-39127185260
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                 ++k l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+
  KHN28145.1 127 PDKVLPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKN 185
                 78999****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-31125184IPR003851Zinc finger, Dof-type
PfamPF027014.3E-32128185IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.975131185IPR003851Zinc finger, Dof-type
PROSITE patternPS013610133169IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 479 aa     Download sequence    Send to blast
MSEVKDPAIK LFGRTISLTH THINDSSSSS APARAPSSSS SPREVTSSAT QQQHEPEEPS  60
RKELTSSQDD DGSHQTTEDL KSPTTSSGIF ENPKTPSPET ETSVPKSSTN GEQSETSASD  120
EKTPKKPDKV LPCPRCNSMD TKFCYYNNYN VNQPRHFCKN CQRYWTAGGT MRNVPVGAGR  180
RKNKNFPATA SHYRHLMFPE GLQGATLNAP NGLHNAVLGN GAAVLTFGPD SPLCDTMASM  240
LNIAERAQSC VPNGFQATEP NSFVSYRKEE DGSTSGHSTG VSVATTSTSS HSGSHESVDK  300
RVEGFTPQLP YFPSGPWPYP MPPPTFCPPG YPLSFYTTPA YWGCMPPSWN NNISSISPQS  360
SVNNSVSVLT LGKHSRDGNI IAPSNSQREM HDMEHKSSEH NVLIPKTLRI DDPSEAAKSS  420
ISMWSKLGIK DDKAGSGGLF KAFPSSKGND MNHHMVEASP LLQANPAALS RSLTFREQT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003528583.10.0PREDICTED: cyclic dof factor 2 isoform X1
TrEMBLA0A0B2R3A50.0A0A0B2R3A5_GLYSO; Dof zinc finger protein DOF5.2
TrEMBLI1KMH10.0I1KMH1_SOYBN; Uncharacterized protein
STRINGGLYMA07G35690.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62534147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-52cycling DOF factor 2
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]